PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462931996
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 469aa    MW: 53302.7 Da    PI: 9.0883
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462931996genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B343.65.2e-14511321195
                HHTT-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
         B3  11 lksgrlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                ++   +++p kf++++  k+  ++++ + + + g+ W+v +  ++  ++++lt+GW++F  ++ + egD+v+++++g + f  ++k
  462931996  51 NSMEKMMIPAKFVKQYVPKECLNIQMAVISsPLGKFWRVDV--ENDESGVFLTAGWSHFLGSHCITEGDIVLLRYEGGMAF--KFK 132
                445679**********555555555555555999*******..****9****************************99999..555 PP

2B356.35.8e-18224298986
                HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
         B3   9 dvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                    ++rl+l+ +f++++g++k++++ l+ e  + rsW+ +     ++ ry+l++GWk+F+k+n+L+ gD+++F  ++
  462931996 224 PQ--LKRLSLSPEFCNRIGLVKTCTVILKTEMDDTRSWQTRA-LAYYKARYLLGEGWKSFCKENNLNRGDVCTFNIVE 298
                33..4679*************99977777777788******9.6788889************************9654 PP

3B355.78.9e-18378458486
                E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEE..TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
         B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltled..esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                +++++++lk+  l lp +f+  +g+   +++t++l++  +s +sW+v   ++ k ++y+l++GWk+F+++n+LkegD+++F  ++
  462931996 378 KELTPNSLKKP-LNLPYNFCHVIGLR--GPRTIILKTsiSSAESWQVHGFMQ-KNRSYLLGQGWKRFCEENKLKEGDICTFNIVQ 458
                45566666666.9*******888988..77789999954555*******555.5569************************9665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.105.2E-1740139IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.71E-1741142IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.33541137IPR003340B3 DNA binding domain
CDDcd100177.36E-1142134No hitNo description
SMARTSM010196.4E-744137IPR003340B3 DNA binding domain
PfamPF023623.7E-1150132IPR003340B3 DNA binding domain
PROSITE profilePS5086311.561214310IPR003340B3 DNA binding domain
SMARTSM010198.1E-10217310IPR003340B3 DNA binding domain
SuperFamilySSF1019367.85E-17219309IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.7E-18222307IPR015300DNA-binding pseudobarrel domain
PfamPF023623.0E-14225298IPR003340B3 DNA binding domain
CDDcd100178.99E-11226294No hitNo description
CDDcd100173.65E-12376454No hitNo description
SMARTSM010196.8E-6376469IPR003340B3 DNA binding domain
SuperFamilySSF1019363.53E-16377467IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.5E-18377467IPR015300DNA-binding pseudobarrel domain
PfamPF023621.9E-14381458IPR003340B3 DNA binding domain
PROSITE profilePS5086312.52389469IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MEELQSCHRF HGGAAVVSSF PVEAHAHDVP TSTSSKGVSC KPQFIRIIHQ NSMEKMMIPA  60
KFVKQYVPKE CLNIQMAVIS SPLGKFWRVD VENDESGVFL TAGWSHFLGS HCITEGDIVL  120
LRYEGGMAFK FKAFGLDGCQ KDFINQDTGT QRSTEKRQGA PPLFPSRKRK MINENPGYHE  180
NDSPDCQENE SPCCQENKNK ASLQNRFDYQ IGTQSWIKKK ITTPQLKRLS LSPEFCNRIG  240
LVKTCTVILK TEMDDTRSWQ TRALAYYKAR YLLGEGWKSF CKENNLNRGD VCTFNIVETM  300
LWHVTITHYN RKQQESPSSS AWDCKSKNDW SGSEGSKSKN DWSSSEGSKS KNGGSSSGVP  360
KRFTKCDYDL GPPSWIRKEL TPNSLKKPLN LPYNFCHVIG LRGPRTIILK TSISSAESWQ  420
VHGFMQKNRS YLLGQGWKRF CEENKLKEGD ICTFNIVQTT LWQVVIMHP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1165170SRKRKM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008669670.11e-140PREDICTED: putative B3 domain-containing protein Os04g0347400
TrEMBLA0A060D1G21e-140A0A060D1G2_MAIZE; ABI3VP1 transcription factor (Fragment)
STRINGGRMZM2G109879_P021e-106(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31640.12e-16B3 family protein